TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M3TK92|M3TK92_ENTHI Niemann-Pick C1 protein, putative OS=Entamoeba histolytica HM-1:IMSS-B GN=EHI8A_035170 PE=4 SV=1
MFVFFFLISVVISITPLPGGERDINNLDQYNNKCRMHNVPGCTAPAINMKSDGTLYLTDAYPAPKNMIEICISEHPEFDP
NVTLGHKTCCDEHSVLDLKEQSTLLDGSFGKCPACYLNQMNLWCGFACDPNSARWTEIDDFKHDNTCNEPDGIDVPSLYY
YLHPLYAQQIYDSCKDTELSGGFAVRSLYPTYKEFFQMISDVNPVMPLHFVYDETGYNGSKYTEMHKCSDMCSCQSCHEM
CTEFIEDEPTFKDYPFLDGTLNIITIISIHLFMLFIMVTITVCGGILSYKTFTQMKKSNPTLLYISYISLGAVTLLGIGF
IIMGIIVVGFPMEGVITSMPWGDGNLLGMILLYIGFGVYVIGYSVYDLYYFVIYTLYNKKESEDIIDSAKVSILGQEESC
EEDPNKVDLTDNFLSKAMSWYTKFLWKFKWIILTVVILCCIVLCVGVFKIVFITDSLGLWVPKNCQTMKDKNYYDEAFGP
FFRINQFMLSDKLHPGNQVLTQPLIVQLQQMIDEIRAIHVEWTDKETGITKDITMDDMCYKPVFGKGCIITSVTGYWQHD
INKIMNTENVTQYIQNCLGNPLATGCADDIGSPVDPHNSLGNYTVGDNNDPMKATILQATFMFNQPNKTAIEWAELWEEK
YLEILDRDYSLVKVAYQAQRSVDDEINRETFTDVLTVLCSYMVMFIYISLSLGNSFYHFNYKTVFVKSRILLGILGIVIV
LFSVFTSAGFFSWINVEATLIITEVIPFLVLAIGVDNIFILTNTIDEQPMYDKDGQYVPVEKRLEHSLMHVGPSMMLASI
SESLAFFLGYLTSMPAVQSFSLYAGLAIFIDFILQITVYAVLLCYDVKRQESHGLDFIPWLQVHDNSLDEQHDFERGSLI
KHLFKYVATFLSYYPVKIIGLFFFIAFFIFSLNYVPKTMLGLPQETALPQDSYIQDYFVALTYLEIGPPVYIVVRDGATY
LNETTQSALCASDNFGCDALSIPNYYDAARTIDGTTFDWIDDYFSWAAQKDCCRLDKDGNICPYDMPNYTECTPCFTNFT
DKKRPVPEDFYKYINRFLTASINETLCSVNGQAYYPDVVWNHINGTKETDYSYVNVSRLRLYHTVLVTQDDFIDAMVQAY
NISDYMNSIFDVKTFPYAYHYVYFQQYFNIVDLCVMDVCLALAAVFIVVMLLMFDPIVAIMIVLCVLMCVIDLIGIMYLW
GVELNAVSCVNLVMSIGITIEFCVHIAHAFLSSPKKTLNDKMKDAVMNMGNNVFVGITLTKFLGVIVLSLSSGLIFVIYY
FRMYFMMLIFGASHGLFFLPILLSLIPSVSLSHITDPFKKMFGRCNKKKSTKGEYQNFE