TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M4NGF8|M4NGF8_9GAMM Uncharacterized protein OS=Rhodanobacter sp. 2APBS1 GN=R2APBS1_1604 PE=4 SV=1
MRSKLIVVAIAAGLGLTSVAAAAAPAQSRTAPASSSEVEQLKAQLAALQAKVDELEQRTDAQSEINVSTGQAVEKATNVT
ATGDKKLAALEKAINNTTLSGKMFFDFTSIDDKNSDKGKSDKSGFGLDVKRFYLGVDHKFNDIWSANLTTDFNYVSNDGQ
TNLFVKKAYVQGKFDQAAVFRIGSADMPWIPFAEKYYGFRYVENTLTDRLKYGNSADWGLHLGGDIGASKSLNYAVSVVN
GNGYKNPGRSKGVDFEGRVGFVPFDNMIVAVGGYSGHRGQETENINAPNTAQRGDFMLAYASDAFRLGAEYFTAKNWNNV
LTTTTDKADGYSLWGSVAVADGVNLFARYDNAKLSKTLDSANKDVYYNAGVEFQVTKGFKLAGVWKHEKADKSVATPVPP
HVQNTKTNEIGVFGEVSF