TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M4RBP1|M4RBP1_PASTR Uncharacterized protein OS=Bibersteinia trehalosi USDA-ARS-USMARC-192 GN=WQG_20120 PE=4 SV=1
MMKKALLSIFLIPSLLLAQETESSYRVAELKQDPATTERLLIFALQTEQWFSVKRLLAIYSTFSQTDQRLVSYANIRLAQ
RSFFNYRNREARKAFQAVQNQANLANEEREIVEQYLSVIDKRESWQFSGRMNYVYDKNVNKTSSDHHIEDTGFIKGEGML
PQKAHGFAYSAEVEKNWNLNGSHNLHFANEISGKSYWDNHDYDELNNRTYLGYAFQNAQYRWAIRPFYERQWFSNHRYHW
ANGVRMEYRQIFAKNWQISTAWEFSQPRYFKQQERNGTIKLASATLVYAFSEKGYLYLSTDFIREQTREKQYSNDLKSLR
AGWKQTWGDDISTQLNGSISLRQYKDFASLGGILPLNAIRRDKIYIANLTLWKNNWHWYGFTPKVQWRWKRQSSNIPSMF
SYSDSYVQMLIEKAF