TCDB is operated by the Saier Lab Bioinformatics Group
>tr|N2S065|N2S065_ECOLX O-antigen polysaccharide polymerase Wzy family protein OS=Escherichia coli BCE030_MS-09 GN=ECBCE030MS09_2283 PE=4 SV=1
MKVKAVPAITFYLSLMLTILVLLFGNEPNKSQYILVIATITVFYIAYITNKITSPASLLVISSFVFLGCRPLLSLFANYD
YRIADWFIEGYMDDDVILANYAITLMYYGYTLGLILCKNTEKFYPHGPYPEKQLLKIKFLLTLFFLGSIGMVVKGIFFFN
FIESNSYVDIYQSNITTPIGYDFLSYLFYCSFFLICAFHIQFRTNKKFLFIAICIAAFSTLKGSRSEAITFLLTVTCIYF
NEVKTRNLRLLITMIFVFSVIFVISEFISMWRTGGSFFQLMQGNNPVINFVYGMGVSYLSIYQSVKLQLLSGGYNVTYLF
SQLIITCSSIFNVKLSLPEISYSHLASYTANPELYNLGFGLGGSYLAESFLAFGLIGCFIIPFLLLLNLNVLEKYTKNKP
IIYFVYYSVLPPILFTPRETLFYFFPYLVKSIFVAFLVTLYIQYKKD