TCDB is operated by the Saier Lab Bioinformatics Group
>tr|N6VPW2|N6VPW2_9EURY Uncharacterized protein OS=Thermoplasmatales archaeon SCGC AB-539-C06 GN=MBGDC06_00351 PE=4 SV=1
MLSISSISMNSLLFQVIIPFVLSAAIIILITIIAERYGTKIGGILGTLPSTIIVAFIFISLNKGVYFASQSAVVVPAEMG
VNLVFLFIFAILSYRSIYIAITTSLLVWILLTLLLFVLNLENIFISIIIYVITLVFTFMLLERVKKIQSVGSVSIQYTPM
KIIFRGLLAGTVIAIAVFLSNIGAVLSGIFSVFPAIFLSTMLISLSEHGPNFAGGIAKSMIFGSQSVMIYAVAIYFSYPL
YGVVLGSIFAFGISIIVMMILLGLRKKIN