TCDB is operated by the Saier Lab Bioinformatics Group
>NP_498893.1 Uncharacterized protein CELE_C06E1.1 [Caenorhabditis elegans]
MATIIAKIESKINEYLKARNKEDWKEKTFTQAEKFSGIPRERIVSMAFLMLSIYVLLGNFLPLFSHIICIFWPVKESFMI
LRQQKNPSDNILLYWILYAMVSLFDYSALPGVPFYYFAKTGLFLSITTNGFDKLKEWSEPALKFTETWVLVTPPPPGEEE
N