TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O01840|PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans GN=pept-3 PE=1 SV=1
MEEKSLLQKLRSYPPAVFFMLGNEFCERFSFYGMKTILFIYLITEHEFSPSKATFIYHLFTCIAYLTPLIGSIMADSVFG
RFKVILYGSSIYVVGHVLLSLGAVPFLSYPIRSSLDFSGLFVIAFATGCIKPCVSAFAADQFTEDQKDLRSQFFSFFYFA
INGGSLFAIIITPILRGRVQCFGNAHCFPLAFGVPGVLMLLALILFLMGWSMYKKHPPSKENVGSKVVAVIYTSLRKMVG
GASRDKPVTHWLDHAAPEHSQKMIDSTRGLLNVAVIFCPLIFFWALFDQQGSTWVLQARRLDGRVGHFSILPEQIHAINP
VCVLILVPIFEGWVYPALRKITRVTPLRKMAVGGLLTAFSFAIAGVLQLKVNETMEFPPSLGRIYLQRVGNESLISDFRY
KSDGRLIGDGMLPKGRTELDAGIYTFNTGLKNESQEIDISTPNKGYVMAVFRLKDAVEVVKFDYKVEKTDNGATRVFVVT
AREDADTLVYAINKKGKILSSCELKSGSYVDVIPGIISDPNVRLYWGPKNSCSGVDCPNTVTLNAQMGAVHVLHIHPSTT
EGDFNLLVRPNSVSILWSLPQYIIITLGEVLLSVTGLEFAYSQAAPNMKSVLTAMWLLTVFAGNLIDMMISGTRLIPHPA
LEFFFYSTLMVIVMGVFILLAMQYTYVEDNDDEITITESEKKDVIALTEIESGTATSDKKE