TCDB is operated by the Saier Lab Bioinformatics Group
O02038|O02038_CYACP Voltage-gated calcium channel alpha-1 subunit - Cyanea capillata (Lion's mane jellyfish).
MFDVQVKQSDGETERQGKWESRPSEDDDDSIPFENSSPQYDWDDNDLTSGKDQDDEKNLALLATQKMATSTYPTKKTKKQ
PGAGQNLRPKRALFCLTLDNPVRSAAITIVDWKPFDFFILASIFANCAALAAYEPLPAGDMTSTNQDLEVAEYFFLAVFA
IEGLLKIIAYGFILHPGAYLRNGWNILDFSIVVIGFASMIFEEYLKSGFDVKALRAFRVLRPLRLVSGVPSLQVVMNSIV
KAMLPLFHIALLVVFVIIIYAIIGVELFTGKLHQTCYDNITNLPASSEPKPCSTTTSYGRQCPSGSICKNNWEGPNYGIT
NFDNVALAALTVFQCTTLEGWTDVLYDINNVSGGGWPWIYFVTLITFGSFFVLNLILGVLSGEFAKEKARQTKSGEFHKI
REKHMLDDAVKGYLDWINQASDIENVTVTQEGAVEPGDSTSERKLSSRRASGISHASSGIYNIAAPNPLTTKERIEKNLT
KFHHRLRRQCRGIVKSQTFYWMVIIAVFLNSLVLAVEHYDQPDYITMFLDRANYFFLGLFTFEMLLKIYCLGIYGYLNSL
FNRFDCLVVLSSLLEVAITVPTGWPPIGISVLRCVRLLRIFKVTRYWESLSNLVQSLVNSIKSIGSLLLLLSLFILIFSL
LGMQIFGGRFNLDEQAPPRTNFDSFWRSLITVFQILTGEDWNAVMYVGIQSWGGIKNPSSIIAIIYFVALVIVGNYILLN
VFLAIAVDNLADAENMTKVNEEEKRKKKDAKLMKKLARKKMDSLDSAEGKKETTESITDGSKDPLSGSEGPEDVELGNPK
SKNGTLRHMGETTSTEMSEGKEARIRPLRLSELNLLKDIPDPMPPESSFFIFSANNKLRYLCYRLAVNKIFINSILVLII
MSSVALAAEDPIGRDVLRNKILGYFDIFFTAMFTFEVTVKMIAFGVILHKRSFCRSFFNQLDLVIVAVSWAAIMLSRGSA
TSVVRILRVLRVLRPLRAINRAKGLKHVVQCVFLAIKSIGNIMIVTLLFQFLFAVIGIQLFKGTFFYCTDRSKMTAEECK
GTFNSYPEVNLANPVVAARTWEKHTFRFDNVFQAYLSLFVVMTFEGWPSILEHSIDSTTVNQGPKFNNRPFVAIYYVIYI
IIIAFFMINIFVGFVIVTFQNEGEEEFADCELDKNQRKCVEYVLTVKPTYRFVPRKRFQYHIWRVVTSRLFEYMIFGFIL
GNTIVLAAQYHNASKLYERVLDGFNIGFTAVFLLECVLKLMAFNAKNYFRDPWNIFDFVIVVGSIADIIIGEISKDGGIK
VNFFRLFRALRLVKLLSQGDGIRTLLWTFMKSFQALPFVGLLILLLFFIYAVIGMQVFGTIRLDSGTVINSNNNFQTFPQ
ALIVLFRSATGENWQQIMMACVNSESVKCEVDPSKTCGTDFAYLYFMSFYMICSFLIINLFVAVIMDNFDYLTRDWSILG
AHHLEEYVRIWAEYDPEASGRMKHVDIVSMLKRIEPPLGFGKCCPHREACKRLVSMNMMMNNDGTVDFHATLFALVRTSL
NIKKPDATETILHANNELRGILKHLWPRTNENLFDKLIPPPDYAEGITVGKFYATFLIQEYFRKFKKKRQEERKKKNADS
TVALKAGLRTLQELGPKIKRAISGDLMEEGTKEEEEKEKEPNKRHSFMAGLRKGIISSFAGDKKRNSYYNALQDTPKQTP
KQTPTSSVSHLAAPNTQGKRISLPSLQTKTNSSQDNIPRGALHEGPSIMQRLSPRLKRKGQRPKSTPFEIIHHDSDDLAL
PQIVLSSQSDVSNPSSKDRDNSRSSTPQHASSIPGADLNSNLLDSNLGPRRSRSSSTSSLVGQALAHEGVPQDEAILRTV
QKELSDSLNISESQLEGAARNIIYDFEKESGTSIPPPEAAPPQEQPNAEQLSPYNDNNDNRSSRPDRTSYL