TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O05256 HYPOTHETICAL 47.8 kDa PROTEIN - Bacillus subtilis.
MGAIPKTGTISPEQKDSQEKNLFQKIWSWEIGVIPLPLYTVLAVIIILAAYYNELPANMLGGFAIIMILGVFLGDIGQRI
PILKDIGGPAILSLFVPSFLVFYNVLNSTSLDAVTNLMKTSNFLYFYIACLVVGSILGMNRIVLIQGFIRMFVPLVAGTI
AAVAAGILVGFIFGYSAYDSFFFVVVPIIAGGIGEGILPLSIAYSQILGSSADVFVSQLVPAAIIGNVFAIICAALMKKL
GDKRPDLNGNGRLVKSKKANEIFNQKEAEAKIDFKLMGAGVLLACTFFIFGGLLEKFIFIPGAILMIISAAAVKYANILP
KKMEEGAYQLYKFISSSFTWPLMVGLGILFIPLDDVASVISIPFVIICISVVIAMIGSGYFVGKLMNMYPVESAIVTCCH
SGLGGTGDVAILSASGRMGLMPFAQISTRLGGAGTVICATVLLRFFTS