TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O06873|POMA_VIBAL Chemotaxis pomA protein - Vibrio alginolyticus.
MDLATLLGLIGGFAFVIMAMVLGGSIGMFVDVTSILIVVGGSIFVVLMKFTMGQFFGATKIAGKAFMFKADEPEDLIAKI
VEMADAARKGGFLALEEMEINNTFMQKGIDLLVDGHDADVVRAALKKDIALTDERHTQGTGVFRAFGDVAPAMGMIGTLV
GLVAMLSNMDDPKAIGPAMAVALLTTLYGAILSNMVFFPIADKLSLRRDQETLNRRLIMDGVLAIQDGQNPRVIDSYLKN
YLNEGKRALEIDE