TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O07032 CITRATE-SODIUM SYMPORT (CITRATE TRANSPORTER) (CITRATE CARRIER PROTEIN) (MLEP PROTEIN) - Lactococcus lactis (subsp. lactis) (Streptococcus lactis).
MKKLKETKISGISLPLYAFFVAVIIVVTLLGKLPLDMVGLTLLLVTLGHLLYFIGEKFPIMNSYLGGGSVFTLIGATLLS
FFHIVPSNVIGAVSNFMGGKFGFLDFYIAALICGSILGMNRNLLVKASKKFIPIALITMVIGFFSVGLVGMLIGNGFADS
VMYVSMPMMSGGMGAGITPLSQIYAAGLAHGNQAAIFSQLAPAVTFGNILAIIGALSIAKVFNKSKYNGHGTLVAATKEE
LAKPKIKLDAQQIGTGMLFAFALLMAGDILNKFFPNIHQYAFMIIIVFILKATNTVPKDLEESVVMFNQVIMTNLTHAVL
AGIGLALIDLNTLASAFTWQFVVLCLTSVVVMGLASWFLARLFGLYPVETAIGAGMINNSMGGTGNIAVLSASDRMEMIA
FAQMANRLCGAIVLIFGGILIRFFY