TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O08581|CIW1_MOUSE Potassium channel subfamily K member 1 (Inward rectifying potassium channel protein TWIK-1) - Mus musculus (Mouse).
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSEELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLG
RVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTALVQRVTVHV
TRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLLLGLITMLVVLETFCELHELKKFRKMFYVKKDKDEDLVHIMEHDQLSFSSVTEQVAGLKEEQKQSEP
FVASQSPPYEDGSADH