TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O13777|YIU1_SCHPO Hypothetical protein C1610.01 in chromosome I - Schizosaccharomyces pombe (Fission yeast).
MITKIDSLPKDLIRKVENGEKLLPNQEIVYFEEKTVPYKIRSDEESFPLGKLITLLVTSQSFILFDEEQNSGWKIPYETI
TLHAKQSKDKPYVYVQLEGEAIRPLLDHILKFERSSGTLHEAPSTEDENEFTDDFLELTLYVTDVDSCYQALCTCQSLHP
DTFSSDNDVENASMGNPMSLFFDPNHQWVTAENVDTSACDNRFDSPESPVLKWHRTE