TCDB is operated by the Saier Lab Bioinformatics Group
>O22769|NDUV2_ARATH NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial - Arabidopsis thaliana (Mouse-ear cress).
MLARLAAKRLLEIRQVFRQPTSQVTRSLSTALNYHLDSPDNKPDLPWEFSEANQSKVKEILSYYPSNYKQSAVIPLLDLA
QQQNGGWLPVSAMNAVAKVIEVAPIRVYEVATFYSMFNRAKVGKYHLLVCGTTPCMIRGSRDIESALLDHLGVKRGEVTK
DGLFSVGEMECMGCCVNAPMITVADYSNGSEGYTYNYFEDVTPEKVVEIVEKLRKGEKPPHGTQNPKRIKCGPEGGNKTL
LGEPKPPQFRDLDAC