TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1
MEIAGYRGGSLRGSLQGSLRRSVSAWRSPSTSDVFGRSSREEDDEEALKWAALEKLPTYDRLRKGIMTGDGGEIQEVDIQ
GLGFQERKNLLEKLVRNAEEDNERFLLKLRNRMERVGIDNPTIEVRFEHLNINAEAFVGNRGVPTLVNFFVNKAIWILSA
LHLMPSGKRPISILHDVSGIIKPCRMTLLLGPPGAGKTTLLLALAGKLDNTLKVTGNVTYNGHGMHEFVPQRTSAYISQH
DVHIGEMTVRETLAFSSRCQGVGTRYEMLTELSRREKEANIKPDPDVDVYMKAVAVEGQESVVTDYILKILGLDICADTM
VGDGMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTALIALLQPAPETYDLFDDI
LLLSDGQIVYQGPRENVLEFFESMGFKCPERKGVADFLQEVTSRKDQQQYWVRENEPYRFVPVNEFSEAFKSFHVGAKLH
EELSTPFDRSRNHPAALTTSKYGISKMELLKACIDREWLLMKRNSFVYIFKVVQLIVLALIAMTVFFRTKLPRNGLEDAT
IFFGAMFLGLVTHLFNGFAELAMSIAKLPVFYKQRDLLFYPPWAYALPTWILKIPISFVECGVWIAMTYYVIGFDPNVVR
MFRHYLLLVLISQVASGLFRLLAAVGRDMVVADTFGAFAQLVLLVLGGFIIAREKIKKFWIWGYWSSPLMYAQNAIAVNE
FLGHSWNKLVDATGQTLGERFLRNRGIFVDKNWYWIGVGALIGYMVLFNFLFILFLEWLDPLGKGQTTVSEEALQEKEAN
RTGANVELATRGSAATSDGGSVEIRKDGNRKKGMVLPFTPLSITFDNVKYSVDMPQEMKDRGVTEDKLLLLKGVSGAFRP
GVLTALMGVSGRGKTTLMDVLAGRKTGGYIEGDIRISGYPKNQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPAE
VDEKQRKMFVDEVMDLVELNSLRGSLVGLPGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNT
VDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGRQSSHLIKYFESIDGVKKIKERYNPATWMLEVTTISQEE
ILGLNFAEVYRNSDLYKRNKDLIKELSTPPPGSKDLFFATQFSQSFVMQCLACLWKQHKSYWRNPSYTATRLFFTVVIAL
IFGTIFWDLGKKRSTSLDLINAMGSMYAAVLFIGIQNAQTVQPIVDVERTVFYREKAAGMYSALPYAYAQVLIEVPHILV
QTLLYGLLVYSMIGFDWTAAKFLWYMFFMFFTFLYFTYYGMMAVAMTPNSDIAAIVAAAFYAIWNIFAGFIIPRPRIPIW
WRWYYWACPVAWTLYGLVVSQFGEYTDTMSDVDETVKDFLRRFLGFRHDFLPVVGVMVVVFTVLFASIFAFSIKTLNFQR
R