TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O25622|O25622_HELPY Cation efflux system protein (CzcA) OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0969 PE=4 SV=1
MMLASIIEFSLRQRVIVIVGAILILFFGTYSFINTPVDAFPDISPTQVKIILKLPGSSPEEMENNIVRPLELELLGLKGQ
KSLRSVSKYSISDITIDFDDSVDIYLARNIVNERLSSVMKDLPVGVEGGMAPIVTPLSDIFMFTIDGNITEIEKRQLLDF
VIRPQLRMISGVADVNSIGGFSRAFVIVPDFNDMARLGVSISDLESAVRVNLRNSGAGRVDRDGETFLVKIQTASLSLED
IGKITVSTNLGHLHIKDFAKVISQSRTRLGFVTKDGVGETTEGLVLSLKDANTKEIITQVYQKLEELKPFLPNGVSINVF
YDRSEFTQKAIATVSKTLIEAVVLIIITLFLFLGNLRASVAVGVILPLSLSVAFIFIKFSDLTLNLMSLGGLVIAIGMLI
DSAVVVVENAFEKLSANTKTTKLHAIYRSCKEIAVSVVSGVVIIIVFFVPILTLQGLEGKMFRPLAQSIVYALLGTLVLS
ITIIPVVSSLVLKATPHSETFLTRFLNRIYAPLLEFFVHNPKKVILGAFVFLIASLSLFPFVGKNFMPVLDEGDVVLSVE
TTPSISLDQSRDLMLNIESAIKKHVKEVKSIVARTGSDELGLDLGGLNQTDTFISFIPKKEWSVKTKDELLEKIMDSLKD
FKGINFSFTQPIEMRISEMLTGVRGDLAVKIFGDGISELNELSFQIAQALKGIKGSSEVLTTLNEGVNYLYVTPNKESMA
DVGITSDEFSKFLKSALEGLVVDVIPTGISRTPVMIRQESDFASSITKIKSLALTSKYGVLVPITSIAKIEEVDGPVSVV
RENSMRMSVVRSNVVGRDLKSFVEEAKKVIAQNIKLPPSYYITYGGQFENQQRANKRLSTVIPLSILAIFFILFFTFKSI
PLALLILLNIPFAVTGGLIALFAVGEYISVPASVGFIALFGIAVLNGVVMIGYFKELLLQGKSVEECVLLGAKRRLRPVL
MTACIAGLGLLPLLFSHSVGSEVQKPLAIVVLGGLVTSSALTLLLLPPMFMLIAKKIKIV