TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O29039 CONSERVED HYPOTHETICAL PROTEIN - Archaeoglobus fulgidus.

MFAELLDRVARFIARRPGFVISIISIILILSAFSAQNVGLTSGTESMFSKDNVIYRQYKLYQKDFGVGADQLFVLIKGDD
VVNSEVYQYLLDLQKRIEEIEGVSSVVSPASIVSSLYGGLPSDESKISIATSLYASDLVPKPTLAMMIIQLGTADDTKQE
EIAIEVEKVISFTNPPHGLVLQLTGGPALSYQIEREIGKSFGITMMVSIILMVLLLFLTFSGAVRKKYTAFLPLVISVMS
VTVVYGLMPILGIPLSEHTNGALPMLIGLAIEYGAQLQNRYEEERREGRDVDDAVVISITRTGLAIVMALITTVIGFMSM
LAPGMPAMAQFGIISSLGLIVAYLLTLTFLPAVLKLIDHWNDAKEQKREEEKSVGTLERSLSAISTLTATRPVGILVAAS
IIVLFGLYAAPQIGLETNYNKYVPQDLTAMQRFKEIERLVGGQATYTLVLEVDELNAETLKEIDELSKYIVEKEELIYDY
SSITKLISEVRKAYGFEGLPESDAELMQILSALPQEEVSRYISGGQIAVHFSSNADSQDEYISTHKSIVRDVEFFGWSGG
YYVTGGPVIYGEMGRLMTSGQTTMTVVAYALIIMLLLAVYRSIRKAVVPLIAITSVIGAMNTIMFLTGTKQTMISIALNS
ITLGLGIDFSIHVLERYFEERAAFSPVEAVRRTIERTGKAITTSALTMAGGFGSLMFSTFPIMQNFGFIALVAILFSLLA
ALTVVPAFLMLTEGIEARISAAINNIKNTT