TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O31645|O31645_BACSU Phosphotransferase system (PTS) mannose-specific enzyme IIBCA component - Bacillus subtilis.
MKLLAITSCPNGIAHTYMAAENLQKAADRLGVSIKVETQGGIGVENKLTEEEIREADAIIIAADRSVNKDRFIGKKLLSV
GVQDGIRKPEELIQKALNGDIPVYRSATKSESGNHQEKKQNPIYRHLMNGVSFMVPFIVVGGLLIAVALTLGGEKTPKGL
VIPDDSFWKTIEQIGSASFSFMIPILAGYIAYSIADKPGLVPGMIGGYIAATGSFYDSASGAGFLGGIIAGFLAGYAALW
IKKLKVPKAIQPIMPIIIIPVFASLIVGLAFVFLIGAPVAQIFASLTVWLAGMKGSSSILLALILGAMISFDMGGPVNKV
AFLFGSAMIGEGNYEIMGPIAVAICIPPIGLGIATFLGKRKFEASQREMGKAAFTMGLFGITEGAIPFAAQDPLRVIPSI
MAGSMTGSVIAMIGNVGDRVAHGGPIVAVLGAVDHVLMFFIAVIAGSLVTALFVNVLKKDITASPVLSETAPTSAPSEAA
AANEIKQPIQSQKAEMSEFKKLTDIISPELIEPNLSGETSDDIIDELIQKLSRRGALLSESGFKQAILNREQQGTTAIGM
NIAIPHGKSEAVREPSVAFGIKRSGVDWNSLDGSEAKLIFMIAVPKESGGNQHLKILQMLSRKLMDDNYRERLLSVQTTE
EAYKLLEEIE