TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O31686|YKVU_BACSU Sporulation protein ykvU OS=Bacillus subtilis (strain 168) GN=ykvU PE=1 SV=1
MNRFVKGIILLSIAAFFAECLEFVVNMILARELGEHGMGLYMSILPTIFLIIVIASLELPISISKFIAESNPKLHESMLR
HAFRMTAIFTAFSTAAASIALPFIPVFDTYHPFIKGIVIGLIPVVAFTSIARGYFMGVQKMGKIAIANVLKKIIQLLCLF
LFFQWYSFELDMAVLISLFVLVVSDVVVLVYLYSQFIMARRALSGQQHIHLRGKDVRKRLLAVSIPTTGLRIFHAVVNAI
EPFLVKGALLAAGVAGTAAIDQYGMLAGVAVTIGSFPAFIAHSLMVVMIPSISEAYALSQYDIVLKRLKQSIFITLGYGI
PAVWVMFQFAGPLTHLFFHSPEAQYYLQLLWPYFLFHLFVMPLQACLIGMGFVKEAFYHNVWSHIVALSMMYVLGSMENL
QMLGIILGMNTGMILLTSLHYATICKALKVSVFLTGGTRTPRIEG