TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O34738|YKOE_BACSU Putative HMP/thiamine permease protein ykoE OS=Bacillus subtilis GN=ykoE PE=1 SV=1
MKSWKVKEIVIMSVISIVFAVVYLLFTHFGNVLAGMFGPIAYEPIYGIWFIVSVIAAYMIRKPGAALVSEIIAALVECLL
GNPSGPMVIVIGIVQGLGAEAVFLATRWKAYSLPVLMLAGMGSSVASFIYDLFVSGYAAYSPGYLLIMLVIRLISGALLA
GLLGKAVSDSLAYTGVLNGMALGKELKKKRKRASEHASL