TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O34765|YLBJ_BACSU Sporulation integral membrane protein ylbJ OS=Bacillus subtilis GN=ylbJ PE=2 SV=1
MNLSKINTLLIASFFLFLTATVISHPQASFEASKTGLSMWWEVVFPSLLPFFILSELLIGFGIVRFVGVLLEPFMRPIFR
VPGVGGFVLAMGMASGNPAGAKLTARLRQENQISRVEAERLASFTNSSNPLFIFGAVAVGFFQNASLGILLASAHYLGNL
AVGLTMRSYGRKEEQHLRRKKTIPFPSVKDALHALHTARLAEKRPLGKILGDAVTSSVQTLLMVGGFIILFSVFNRLLSV
VQLTDVLSVFTKGALTLFQLPTQLDIPLLSGMFEITLGSKLVSETDVSLLQKAIIVSFILGFSGFSVQAQVAGILSETDI
RFKPFFIARLLQGVYAAVFVMLLWKPLYTAWHDPYQYVFKSLNSSDMSTAFINGWNLLVQIGPAVTLCALFTYIIIFSYR
LTNGTKKG