TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O34991|YTVI_BACSU UPF0118 membrane protein ytvI OS=Bacillus subtilis (strain 168) GN=ytvI PE=3 SV=1
MNQSYITIFFRTLFVISMTAGSIAAAYYSFPLTYPFLIALILSSVIHPVVDYLDKVTGFPRTINVLGVLAFFLLAAFGVL
TILVAEIVTGTAYLAKTLPPHISTFISYCEKLFTTHIQPLYNELTLLFQELETNQQASIVTHIQTLGDSAAKNAGLLLSH
ILEMIPRFFALLPNTAAVLIFSLLATFFMTKDWHKLKAMLVLILPDRVTANSKAISSELKKAMTGFIKAQAVLVFITMVI
VFIGLSLLKVEHAATIAFLIGLVDLLPYLGAGSVFVPWILYLSITGQLPQAIGIGILYLVVLIQRQLTEPKILSKSIGID
PLATLIALFAGFKLFGFLGLIAGPAVLVIIQAFITTGALKEIWSYITVQQK