TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O50455|O50455_MYCTU Magnesium transport protein CorA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=corA PE=1 SV=1
MFPGFDALPEVLRPVARPQPPNAHPVAQPPAQALVDCGVYVCGQRLPGKYTYAAALREVREIELTGQEAFVWIGLHEPDE
NQMQDVADVFGLHPLAVEDAVHAHQRPKLERYDETLFLVLKTVNYVPHESVVLAREIVKTGEIMIFVGKDFVVTVRHGEH
GGLSEVRKRMDADPEHLRLGPYAVMHAIADYVVDHYLEVTNLMETDIDSIEEVAFAPGRKLDIEPIYLLKREVVELRRCV
NPLSTAFQRMQTESKDLISKEVRRYLRDVADHQTEAADQIASYDDMLNSLVQAALARVGMQQNMDMRKISAWAGIIAVPT
MIAGIYGMNFHFMPELDSRWGYPTVIGGMVLICLFLYHVFRNRNWL