TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O51234|O51234_BORBU Phosphate ABC transporter, permease protein PstC OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pstC PE=3 SV=1
MHLSLKTKRKIIEIIFKSFILISAIISSLSILFLGLFILKTGIMPFLNNKIKILNFLFSTNWDPTSNLQKSYGILAFIIN
SFLTTLFSILIALPIGLGFAIYLLEKAKGFYRQFLQTVIELLAGIPSVVYGFFGSTFIAALVKNIFQREDNLGYNLISSS
LILSIMIIPTIISVCYSSLKAVPKSYKFASLALAATDWQTIYNIIIPSASRGILAGTILAIGRAIGETVAVLMVGGGSPL
FIKNIFSPIRTLTVNIAMDMGYASGVHREALFSTALVLLLFSIITNLLKNFILSSNKGLKKK