TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O51235|O51235_BORBU Phosphate ABC transporter, permease protein PstA OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pstA PE=3 SV=2
MYNSLFYFKKKQTLFLNKTQSFVPFKTEDGKEIQIAFIVNKNINTDKISIEDIHNIYNNKISHWGSISDQGIDIIPIASS
IDSISNKAILKTLIKNNVFNKRYIKIEPSTKKILQTINSTIGSVGYLTKKEFESLDFKLYPNIKALKIKTMSVLISKKTL
TKNENEIINTLGVDEVEKLIKGKEKWVNLISKDIKLKIIKYLDQEENIIQTIEKTEGALAIVPWHYFQNFKAPFIKMHYI
DKSSPLNLNFILSIPRDSGAYGGISYLILNTFYVILLTTAISICIGIGTGIMLAEYTSSKIFYKILSMSVDILSSIPAII
FGLFGLIFFVPILGIGILSGAITSSLMILPMIVKTTEEAFKTIPKSYKYASFALGANKTETIIKVMVPAAIPGILTGIVL
AIGRALGETAVLLFTMGTNLGLATNLNEPSRTLTVHLLMLFQEGHLDKGFGTASILVIMVLIINLTSKFLINKLYRIK