TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O67182|O67182_AQUAE Transport permease protein OS=Aquifex aeolicus (strain VF5) GN=abcT3 PE=3 SV=1
MNLSLILELVRQEIKNRYADTVLGIWWAFLWPILLVLIYTLIFSHLIGAKLGHENTVYAYSIYLSSGIFPWFFFSNSLSR
ITGIFTEKKFLFTKIPIRLEVFPVVVIISELINYLIGISLVTLISFITLGFEGIKYFYLFPVALYLMIVYSFSIGMVLGT
LNVFFRDIKEIIGVFLQIFFWFTPIVYTLDILPPFVKKLIYYNPMYPVVSIHHLVFVNYLDLHLYSLLGFLLASPLVFFV
SYYFFKKLEKDIKDFA