TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O67998|O67998_TREPA 30kLP (Hypothetical protein) - Treponema pallidum
MIRRRYRGCTQGAWIVSVGMLFASCTSGAWKASVDPLGVVGSGADVYLYFPVAGNENLISRIIENHESKADIKKIVDRTT
AVYGAFFARSKEFRLFGSGSYPYAFTNLIFSRSDGWASTKTEHGITYYESEHTDVSIPAPHFSCVIFGSSKRERMSKMLS
RLVNPDRPQLPPRFEKECTSEGTSQTVALYIKNGGHFITKLLNFPQLNLPLGAMELYLTARRNEYLYTLSLQLGNAKINF
PIQFLISRVLNAHIHVEGDRLIIEDGTISAERLASVISSLYSKKGSS