TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O69413 ESPD PROTEIN - Escherichia coli.
MLNVNNDTLSVTSGVNTASGTSGITQSETGLSLDLQLVKSMNSSAGWTESSPLPTPPAGHSLVTPSAAEDVLSKLFGGIS
GEVTSRTEEAEPQRTSYPYLSQVNTVDPQQMMMMVTLLSLDTSAQKVSSLKNSNEIYMDGQTKALENKTQEYKKQLEEQQ
KAEEKSQKSKIVGQVFGWLGVALTAVAAVFNPALWAVVAIGATAMALQTAVDVMGENAPQGLKTAAQVFGGISMAASILT
AGVGGVSSLLPKFGNVANKIGSSVVKVVEKAAEALVKNVFAKISTVAEGVTNGIRSAGTTALNNEAAQLQMLSQLAAFAV
QNLTRQSESLGESAKLELDKAASELQNQASYLQSVSQLMSDSARVNSRIVSGRI