TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1
MVEPASPDSDEGISLLEFHGNGDRSWQLNFDDFQVSPEHKEKKSPSKLHNCLGCLGPEDNVADYYQQQVEMLEGFTEMDE
LAERGFVPGMSKEEQDNLAKSETLAIRISNIANMLLFAAKVYASVTSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPN
PYQYPIGKKRMQPLGILVFASVMATLGLQIILESLRTMLSSHKEFNLTKEQESWVVGIMLSVTLVKLLLVLYCRSFTNEI
VKAYAQDHFFDVITNIIGLIAVILANYIDYWIDPVGAIILALYTIRTWSMTVLENVNSLVGKSARPEYLQKLTYLCWNHH
KAIRHIDTVRAYTFGSHYFVEVDIVLPADMPLQVAHDIGESLQEKLELLEEIERAFVHLDYEYTHKPEHARSHC