TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O81209 RESPIRATORY BURST OXIDASE PROTEIN A - Arabidopsis thaliana (Mouse-ear cress).
MMNRSEMQKLGFEHVRYYTESPYNRGESSANVATTSNYYGEDEPYVEITLDIHDDSVSVYGLKSPNHRGAGSNYEDQSLL
RQGRSGRSNSVLKRLASSVSTGITRVASSVSSSSARKPPRPQLAKLRRSKSRAELALKGLKFITKTDGVTGWPEVEKRFY
VMTMTTNGLLHRSRFGECIGMKSTEFALALFDALARRENVSGDSININELKEFWKQITDQDFDSRLRTFFAMVDKDSDGR
LNEAEVREIITLSASANELDNIRRQADEYAALIMEELDPYHYGYIMIENLEILLLQAPMQDVRDGEGKKLSKMLSQNLMV
PQSRNLGARFCRGMKYFLFDNWKRVWVMALWIGAMAGLFTWKFMEYRKRSAYEVMGVCVCIAKGAAETLKLNMAMILLPV
CRNTITWLRTKTKLSAIVPFDDSLNFHKVIAIGISVGVGIHATSHLACDFPRLIAADEDQYEPMEKYFGPQTKRYLDFVQ
SVEGVTGIGMVVLMTIAFTLATTWFRRNKLNLPGPLKKITGFNAFWYSHHLFVIVYSLLVVHGFYVYLIIEPWYKKTTWM
YLMVPVVLYLCERLIRAFRSSVEAVSVLKVAVLPGNVLSLHLSRPSNFRYKSGQYMYLNCSAVSTLEWHPFSITSAPGDD
YLSVHIRVLGDWTKQLRSLFSEVCKPRPPDEHRLNRADSKHWDYIPDFPRILIDGPYGAPAQDYKKFEVVLLVGLGIGAT
PMISIVSDIINNLKGVEEGSNRRQSPIHNMVTPPVSPSRKSETFRTKRAYFYWVTREQGSFDWFKNVMDEVTETDRKNVI
ELHNYCTSVYEEGDARSALITMLQSLNHAKHGVDVVSGTRVMSHFARPNWRSVFKRIAVNHPKTRVGVFYCGAAGLVKEL
RHLSLDFSHKTSTKFIFHKENF