TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O86190|O86190_DICCH SapD protein OS=Dickeya chrysanthemi GN=sapD PE=3 SV=2
MALLEIRNVTIEFLTPDGPVKAVDRVSINLNEGEIRGLVGESGSGKSLIAKAICGINKENWRITADRFRFDDVDMLQLTP
PQRRKLVRHNMSMIFQEPQSCLDPSARVGRQLIQSIPGWTYKGRWWQRFNWRKRRAIELLHRVGIKDHKDVMRSFPYELT
EGECQKVMIAIALANQPRLLIADEPNNAMEATTQAQIFRLLSRLNQNNNTTILLISHDLQTMSKWADRINVLYCGQTVES
AVSDELISAPHHPYTQALIRAMPDFGCSLPHKSRLNTLPGAIPSLAHLPVGCRLGPRCPYSQKQCMTAPPLIPVRNHWYA
CHFPLNMEES