TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O86191|O86191_DICCH SapF protein OS=Dickeya chrysanthemi GN=sapF PE=4 SV=1
MVETLLEARNLTKTFRYRTGWFRRQHVQAVKSVSFTLRERQTLAIIGENGSGKSTLAKMLSGVIPPTSGELVIDDHPLQY
GDYHYRSQRIRMSIQDSATSLNPRQRIGQLLELPLRLNTDLTPQEREKAINLALRQVGLRADHATYYPHALAPGQKQRIG
LARALILQPKVIVADEVLASLDMSVRSQIINLMLELQEKHGISYIYVTQHLGMMKHISDQILVMQAGEVVERGSTADVLA
APLHDLTKRLIASHFGEALTADAWRSRDR