TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O86575|O86575_STRCO Oligopeptide ABC transporter ATP-binding protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5480 PE=3 SV=1
MSDEAKDEAVAIPAQSDGTESTSAGAATLTKGAAPGETLLKVTGLQKHFPIRKGLLQRQVGAVRAVDGIDFEVRSGETLG
VVGESGCGKSTMGRLITRLLEPTAGKVEFQGKDITHLGVGGMRPLRRDVQMIFQDPYSSLNPRHTIGTIVSAPFKLQGVQ
PEGGVKKEVQRLLSVVGLNPEHYNRYPHEFSGGQRQRIGIARALALNPRLVVADEPVSALDVSIQAQVVNLLDDLQQELG
LTYVIIAHDLSVVRHVSDRIAVMYLGKIMELADRDLLYKTPMHPYTKALMSAVPIPDPARRGAKSERILLKGDVPSPIAP
PSGCRFHTRCWKATQVCTTTEPPLKELRPGQQVACHHPENFEDQAPQDVVLLTAAKEAAELVSEDALAESAATSAAVAAE
VEASEAEASEETASSDAASDGAASEEAASSDAASDDSASDGAAPKEAASSDAASDDAGSSDSVSDDAAPDDSASDGDEPA
AESAGSTDEEPPAKEK