TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O87561 Hypothetical 27.6 kDa protein - Bacillus pseudofirmus.
MSENQLIKKIILFELKNTPFIKYLWMVAAMGLIVFLGSQFINEVSGGGRFPIIYDFLFFSALSLAYTVRYKPFNIQDIKG
GLYASSFFILLKQTPIADRVIMKSRFIMSAIYILTFNTIVFVLFYVFSNNIKEVLSVSEAIILGLSWLAISYVWGGLYAA
GEPGGRYSPVALVIWSVVYIAVLFVLLTGFNLLAGAPYIIWSINIVQTNPMLLLGISFLFMIIATATWIYSYRYYENKTS
YHL