TCDB is operated by the Saier Lab Bioinformatics Group
>OGF02869.1 hypothetical protein A3H14_00205 [Candidatus Doudnabacteria bacterium RIFCSPLOWO2_12_FULL_49_8]
MLLAHADQIVRQVSQSQLVVVGTPQTAFLASLVVAAVLFGVYFLMDALPRRQRQHLPKNKELRLIKAMIVFVMLGIMAAG
WDIWWHRAIGRDSFWILPHVFLYSSTILAILIGIHIWRHTREKIWKKIAFVLTLIPLSAPLDNFWHSIYGVEDLSRPVSL
SWSPAHALLSLSALAALGLLFVELKKFHKDKDFNFYGHLCLGAIMGGIFFLILPFHPTEGWGQVWGFAGAGVIACWLVGY
LFIAERAMKGHASAVWVTMMFLLLSLFSYGKETSLNIIMIPHDRPPLWLFIFSFILPALLLDVTKGRFGYPARGFLAGTL
WAALLVGLSTQFFAPEFQYGLYEIVIALFAAALGGLLVGTIFQLWARYAKTDHPL