TCDB is operated by the Saier Lab Bioinformatics Group
>OHA76809.1 hypothetical protein A3H01_00845 [Candidatus Wildermuthbacteria bacterium RIFCSPLOWO2_12_FULL_40_9]
MRREHLRVTLSCAFGGWLGAYTGLFLSPGSALAFIVGAFVGGFCGCIVYDVKAVSCLIKNIARIVSEITQRGKTELCSER
QPIVVATDKLGLGVGSAIVLLIVAGSVLADIAGVSHIGFAWLILSLSGAGAFAIMVLITGMIIDSHFPLDIERRLEHRVN
SILLTLPNFLKAGLFYARMTFYVLVLLAFLGVTSILSLIVIFLSYCATLIAMGIGMIVYQPIKIAASDLRAITFLGSAIG
AIAGIAYESPVIGMIAGGSIGFTLYFVARPLPMFDSKKIENAVNSTQNKFWQLFASFHGSLWVGSFYHKFPVPEH