TCDB is operated by the Saier Lab Bioinformatics Group
>OHB50947.1 hypothetical protein A2Y10_08285 [Planctomycetes bacterium GWF2_41_51]
MRNFGWSKLKIIFAAQKTLLLAVITISTLFPLVFVKLQEPTFTLVIFKLLAKAGSLCGATLLVWQFLLGFRDVAGKFIRD
FLWVLEIHKKIGQYILLLIVMHPVFITLYYIEKEKINPLILQGQSPFKWWVLAGEIAFAVFLIVVLTSIFWRQKMGRTKW
YTVHITSYFALAIVIVHAFAIGTTINKTRAFYYWIILTIIAAGFLLYRLLCGVGFFVKKHRVVSVEKVGPDVTRISCQPL
GRKIVPHLGQFIYFRRGLKDSMRPFTVSHYQPQTGEFSITVKSAGRTTQNLQWIKPDEIVYIDGPYGIFSQTALESHRPI
VMIAGGIGITAFTRLFEELAYEPDMEIHLFYGNQKKHEIVYKQELENVENVNVIHVLSDEPQYSGETGFITTDLLRKYLK
KSLVNYEFLICGPPAMTEKLESALLSENVPDTQIHHELFDY