TCDB is operated by the Saier Lab Bioinformatics Group
>OLS12314.1 hypothetical protein RBG13Loki_4071 [Candidatus Lokiarchaeota archaeon CR_4]
MTEITYEGKKYRFSTWSLVLFPIGTIIGYFAIYYITEAFGVWIHWFVAEQTAWLLRLFGVGVNVVPVSTFPIPSPLYEGR
LVWWQFEVLIKPPGITPYLSTISFTHDCSGFQAIAMFLALILFIPHSQDMNANRGIWRRKTLSIVVSTLLFHVVNVLRMV
IQLSLYAGGANWDDIHYSISAASSIIAVLIIVLMNRWVPEFILSIMVIGKRIGTFFKGLKKNRLPVEHQLPDEKSTDFSP
ENNTSENSLDLK