TCDB is operated by the Saier Lab Bioinformatics Group
>OLS22727.1 hypothetical protein HeimC3_30010 [Candidatus Heimdallarchaeota archaeon LC_3]
MKIITLFLIIFCCILIIPVFLTNSIIIDDNDSLLMKNDDFLLQNSDENISLLHMAPITDDPFSFWEPISFLPNQYYNTTD
NLSIHFFLFRYNNNGGDINNYSLKLTLPLGEYHDINFDFNSKNTPDFVNITSLLTDGMPNSGLKSYSEWSLQYLFTFDGN
FSYFYKIDINENSLFGTISDLEGHSISFIRLRISSLDYFLYSGKTKFILKGYWEFWGKKLTQTEIGYKNDSQYLVTYIIP
RTDSLVYQGVTKVSHLKIDQLDYNFRNGYNYGNIKILFSNLRMVRVAPSIDKTAYIEFNNWEIIINSKQNFPLFQEMNLN
LNDGKYNVEGGGRLKDSYSVPLIQIGEYSINHSYIVSEYNTKWGRWVENECLDIITLEGTETLTVASGEFTVNKFTTYSY
KTDYILPFTRSELLLNTRTIEYLTEKEIVIKSISYNEDDQPFLLMELFPDNQNYEEFFDSWKESNDLTDTFVYINSDNEA
DTAISNFSLDFIIFVILILGSKRIFKRNK