TCDB is operated by the Saier Lab Bioinformatics Group
>OLS25664.1 hypothetical protein HeimC3_14120 [Candidatus Heimdallarchaeota archaeon LC_3]
MKIRLLDFFFPRINSPSDEYSQKMRISVTVLVLSIFVFLFFQSVYVLEPKFFNLSSFVRYERYPTILTFNTLLGPIFLSL
GLTWLIKFIFLFRRGVSRIENQVLQSNVSNRDSKLLLFILNIIFVFMTVSIGYYGYNLSLASIFLISLQIGFATLIVIIL
DDILTSGWGYGNGFLIFSSGIILTNFIWNLFAIFPFADGIVETGGFTLPIGVFIAVVQVFLQFGIVEAFSTLFIRVEHPT
NSIFSFLSTLALVFIIYWLLSKENSKKHNHNEEYSKNNLDRNQKVASIDIILITTFTLCFFTLLFILSEFLQSIIPGFII
ADLLGQFDPEIMQPTSGIVYFLPLVNDSLFSLLLKGQYDQIFTLVVQNIILMITLVLTFFIYNLSKGNYQHQSPERMEAV
SQFSAKTTIYQLIILVTLFNIIGTAIPSLTCVLIVAIIFFLRNEYSFSDVPILKYSFYTVLVGALGFFILFFINIIETPL
FTGLGGPLNIVINIVGLTSLYIILTIIMFKNRKNYQINKLKQI