TCDB is operated by the Saier Lab Bioinformatics Group
>OLS26559.1 putative ABC transporter ATP-binding protein [Candidatus Heimdallarchaeota archaeon LC_3]
MTTKAESPQTSVFSTMLISKPHRRANYALRRRLLLIMKQPRLSWMNLEGYDIFTKIIAVLGGLILALVITNIGSGINYGF
HFITGDIDQQFQWFEITGNSLPVILVLFIIGAFLTNKTFQWWVDRPVGTVAELNTFIIAQMQPLSSKFEVEEERIKYETK
IQMAHRKYKRKLLKQLQSHIANDFELKNSRKILVDVAKSLKSSGTKEEIKAEVDEVLDWAWSTLDHVHKGSRLTYWDNVS
GIDRLIISDHLNQKQLIEIEAEAEGIVDELNLLVFANRYSSVMLPLLQQSVKFSKAFEEHCCTPKFVETFQKGEKHDENF
AEAYRVLLSKSLGMQEVLKSTVRQFDRMREAKEELIKEAQALNLPKLELIANEFVTEEAFQSYLEMIEHLRESLSHVAKD
LRKLNFKQFPKGTRKDLKFITRFYLVLEKLRFITTWFEDIASYTTVVGGIGYETGVITSQSEIEKDVVLKVEDIFKNYHT
GGGTIYALRGVSFEIKKGEFVGVIGPSGSGKTTLLNIMAGLDNPDRGAVYVDGMNLQSLNDKQLTSLRRDKMGFIFQFYN
LIPMLTNKENVAYPAEVGGNTKDLSNRVSNKLKSVQLEQFERQYPNKLSGGQMQRVTIARSLINTPSILFADEPTGDLDS
VTGEEIMNLLSSFNKEHETTVIMVTHDRSLLKYCNRIIDMKDGRLIEELP