TCDB is operated by the Saier Lab Bioinformatics Group
>OLS26561.1 hypothetical protein HeimC3_08800 [Candidatus Heimdallarchaeota archaeon LC_3]
MVKPTSIIFGLKTVWRRKQKNLFAIFAIALGVSLIAGISITRNSLGEGFGVFFTYSLGERDGSVSSVNGFIDEPWADAIG
NRLVTDVDDVVAFTTSFSLPISTSTDEGQINVVTWLIGINQTEDSAVFGRLITTNGDTVSVAGVAAGEAYVGKTLADDLL
LTTDVSDEERSNQFDYSLSIGPITIEKTLTVKGIIKNEERGATGGNLAVYTNLNNIQEEIGNVLVMGGYPVPHPITLISL
KFSDNIKTVDDGDELVEAMKDSLNDLPVVLGIGGVETLIISAERVTIKNFGKVLSAQLSDMLMIFGFIIIFAGLLLIVNI
QFMTVEDRQQQTGIQRAIGTQRRQIVIANLTEFLVTGIIGGLVGIIGGMIYSQLLILAFGNAFEFDGSLIPVIIDTDVMI
MAFFTGFFLALLTGLLPSIRASRIHIVETLRGVENKAESIERGTGMMGLYVGTILTLLGIVSLAGLNGQPWDFPNAYKNI
DNAEAIFFAVTFLLVGLSVLLSYFVSKDLALNIAALLLVLLPVVNALFIFGIIEEGVGSGGMNLFLGMILSMIAGSILLI
GINLHRVADFAEKLFSRTYSAVAMLSFRQMASQRTRSTLTFSIFAVILTLNIFLASFAYSMRYGSVNQVEAQAGGSDILI
FSGQAFNSTTTTIFLNGLKDTSKFPGITWAQAFPNAIDYNVSLTTNGEETDDLDDTETWRLNFFAINNQSLWESEQDFLD
NKPKLNLLIETEKIDTTKFTFSADYSEGFEIDGRVGFGDRHKDSNLDENKRFWSALAKNEYVTDKSDQKSKPFIVVSPII
DPEASGLITYLKKVGDSVWLSLKDGTYKEFVIAAHSEGNPLFDARYLQGIEPGPSGSQGFGAFISETEARDLKVFNPTEN
ISLLDQNSHFLVSGKDNVEITSKENVKLAQDIEAWSNGVDTVTKDGSTFDTFRKVFGFYGIVTISIYELYEILFDGMFRM
FGFLQIFTSFGFIVGVLGLLVVSVRSVQERKREIGMMRSIGLKSNDVLISIMLELSVMGVIGLAIGIFNGNVLGLGIVRL
MLGVDAPFLIPWFDPGMVIFGISLPGGPGSILFYTVLTLGAAFVAAIIPGRSASKIPPSEALRYTG