TCDB is operated by the Saier Lab Bioinformatics Group
>OMJ81198.1 hypothetical protein SteCoe_18374 [Stentor coeruleus]
MIPGILGLLLLIAKITLIILTVTNSLTNSDESIDLIFKIFNTPKNPNFSKSFESIIPDLTAIFMCILTFIEAKNAHDYLK
ETMRLGFIVLLCTSFFDFTIWNMLYFLCLANWIIFRFLLEYEFNFKKLSFSILILSSVHLMTCLRVFYDAGFYRPLSIFS
FEFLNVSLIYIVFLHISKTRNFEGENSVKEGFLQSRESLPNKELVLFIYFAIKVALILWSFIFVNFAGVFVILWLMYTGI
EPDIKKCNKVLKFCIVPIMILKYLVLNFTTQRKSFYDFSFILVGTAFISYFTVKLQVLLEKGNISLDICEKTDPNKNASI
NQPIINTDPSVITFNFSLFMKKAVTQKDPKEEIPNAIPLENNNQEDTSNTLYWYKADFPNTALDKLILIPFKCYYIISIF
SVVLFGLISLDLFHAVFIIFIIFFLQSKNNIKKYWDNFNVYLFIAIALKYSIKLIFDVMNINEDNDIIKNSLGLGYSQTE
AYYTLFPLMISTLFQSFINNHLKADTEVIFPSNPISAMLKKYKPLLHIFFTYSFCIVLSIVIKTNILNLLRIIFLLATLL
IHYINTRRNLNNPTEKVKSCLMILRFYSQTLMFTRYTFLCVVSIFSLEWMNLPSIGFEVYKTQEEIYFYILADFLLSLSF
KAMIRLISQKSETKKTEEFVKFIVVKIKAEHFESNNKSITSKIMNEFFSRSYEYKLITEPFCIYYSFCIFTLSAFWQMTI
FMVIYLIIIGVMQIIYIYNHKELFKHFNMNARLLECDDYSSYDSEDKKKTYQEVRKWEYRALLWALLTITTVIALIVTYS
VQLFNNILIASESDASYIESSYKYQIIITEIHNTIQSCYGYVIILIILVLERLNIQALIPNEVKNIIDGWEESKTEGNAD
KNSSQKKRDDGMAIVAAGFMSTWKKIQDKKKIDQEIPKSKPDDSNEIVLPALPELTSTKSELSKRRGSTFQQRNRGHTTT
RFNQKDEVVKMIEILRPRIKLIQALGENYKEVNYNIESDIDFISSLDLLKSIFEVFMIMLLLILAFYKLKIISVLYMITV
LIIIFFKKFDKTNIIAFILIIGVWSQYILIFLSFSIDHLGLDYIYPESQDLYNFFEFSGTEIYSVYFDLLCTLVGFIYFY
YLAGRTNQLIELKKLKNQIDENINRNTNRQQEKAKFEVKTEDKTEDKPEAEAEAEAEADAKLEELNFREVLKNFMFKAKV
LFYKFSRFSTLIFVMLFITQSTGIIAAIYCCICLLFVLKENQIMLLSSKSSVSNPQQEILIQSHNSFQAEHYKKSNLTPI
LSQPETMTTLTFHGIQESELKSFTLYLNLFLNILILELACQLFIQMPVGLVTKENDHWFLDFGLIKIWNDETMDSLTNFD
RYSSLNFKIYSFAFLLLILRMINSEDFKSSHKNECIIIEESSKKIVKSMEENLNKRLKIETDEHNCIRLRFERKVELLLD
KLIAWNEADEKVKRMKFNIKNFKGDLVKEPWENEEEDEDVENKYNLNRNSILSYVNPFLFKKFMKSVSTLSSQQPDFEEK
QSDCLKRKINRHNFYTGKKNSNQDFMQFGKRYYLNENWIPYSYSKYPQIFLFAILSNLDVFVYFLLFVNHFMYASLVSLV
LPVSALSYGMIQYPRPKTMYFRFILYYESVIIMLKYIFQLDILKEIFAEALNQYKDPFKIGLNLAKNTYSETLFYYTLWD
NAVIFSVLILEYYLLRVGLLNETEIDPICNKTANHKKTLSRENLNINSKPGKDLYPYCLMMQLIITLYLFLFYSRMEGNY
QDIDQAIRRNKFQGEMVFSVVIMVVIIIIERIAHNRHISDLRAEVRNTFEADNNDNNQKQNNSVHYVVKKFLHFALLIIF
NILVFWFFPINSIYKYKNTFSCSDLHDNNTCNNFEINYFLQGFYVICTIYFAITAQQIRLGLPTFTNSTFPSMKKPSRTE
YYFFKFYRAVPFLFELRTFIDWTFSKTSLNLFQWLKLEDINARLFLTDYEQQSLKNAEDQKEISIFEKIQYGVCSLFGLL
LIILLPLFIYSTSNPFIYKNEVLSTSLSLKIYAGSNQLMLFSTSTAYNPPEYNQTEWDLFGNSSFISGSEKELTQLLEVP
SEPDSIWDVTSLKRNKFCKDLSTVTDLSSVGLTIDHTFIRPYPKSSQSSSLKSDYNFDSKEYLDGFIEVLCKQSTNFVVL
TDKLEQIIRIPSAGTVVPETVHDISFTSNLVVKLENSSEVYWTVGRTNENNKLKPLKFFVISDEYSPATFSFSIFGFYFS
VVYLLGRLIRYITVGSGMNVIMTDMKDPRHLIILCSQIIYNRSKMNLRMEKILYFELLDILRSPESVKYLTGRNSVKLKA
D