TCDB is operated by the Saier Lab Bioinformatics Group
>P0A2I9|HISQ_SALTY Histidine transport system permease protein hisQ - Salmonella typhimurium.
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVPDLVLMLLIFYGLQIALNVVT
DSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQV
ILKATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL