TCDB is operated by the Saier Lab Bioinformatics Group
>P0A2R8|CORA_SALTY Magnesium transport protein corA - Salmonella typhimurium.
MLSAFQLEKNRLTRLEVEESQSLIDAVWVDLVEPDDDERLRVQSELGQSLATRPELEDIEASARFFEDEDGLHIHSFFFF
EDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRARSQAMVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSR
VIMEGHQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL
MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMILAGLAPYLYFKRKNWL