TCDB is operated by the Saier Lab Bioinformatics Group
>P0A3G5|LCND_LACLA Lactococcin A secretion protein lcnD - Lactococcus lactis subsp. lactis (Streptococcus lactis).
MFDKKLLESSELYDKRYRNFSTLIILPLFILLVGGVIFTFFAHKELTVISTGSIEPTKIVAKIQSTNANPIIENNLKEGE
AVKENSLLLKYNGTPEQTQLSELLTQKKQALDKKVQLDLLQRSLTNEKNEFPTADSFGYEKSFENYEAQVKSLEATIQKS
NQAVEDQNKSTESQKQAIQNQVATLQQAIQNYSEIENAVSSGGGVSQDNPYLSQYNSYQAQQATLEADLKNQKNPDETAK
QAAKSQEESLKSQFLSGLASSKDSLKSQIQSFNVQESSLTGSNAYDNSQSSQILTLKSQALSASNKEMTDLNSTLTDLET
KISLQKQDDQYSQVFAEQAGVLHVLPDILGMKKIPIGTPIAEIYPLLKSETQVNLTSYIPSTQISGMKVGQKVRFTVQQN
LPQPEILTGIINQIDSAPTAFKEGNAYKVSATTTINAKDLPNIRYGLQGKTVTIIGKKTYFNYFLDKIMGRGNQ