TCDB is operated by the Saier Lab Bioinformatics Group
>P0A4N5|OCCQ_AGRTU Octopine transport system permease protein occQ - Agrobacterium tumefaciens.
MDYSQLMGFGPDGWGYDMLRATAMTMAVAFSGFTIGLVFGCLGAAASLSSSGALQAAASGYTTALRGIPDLLVIYLFYFG
SSSVISNVASLFGSSGFVGASTFLIGALAIGVVSGAYQTQVLRGAVLALNKGEIEAGRAYGMGALLLFRRIVLPQAARYA
LPGVGNVWQLVLKESALISVIGLVELMRQAQVGSGSTRQPFSFYLTAAALYLLITFVSGQVFRLAETRSMRGLQRGV