TCDB is operated by the Saier Lab Bioinformatics Group
>P0A6M2|DSBB_ECOLI Disulfide bond formation protein B - Escherichia coli.
MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALIGAIAPKTPLRYVAMVIWLYS
AFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLV
VISQPFKAKKRDLFGR