TCDB is operated by the Saier Lab Bioinformatics Group
>P0A8S5|USPB_ECOLI Universal stress protein B - Escherichia coli.
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQVRLVWYIYAQRYRDHHDDEFI
RRCERVRRQFILTSALCGLVVVSLIALMIWH