TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0ACX0|YDGC_ECOLI Inner membrane protein YdgC OS=Escherichia coli (strain K12) GN=ydgC PE=1 SV=1
MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATIIFSMWSIIPYFVYLVSLWYFT
GMMRLPAAFVGSVACWGISAWVLIICWIKLH